assume that a lipid bilayer is 30 a thick a calculate the number of amino acids it would take to

Name: assume that a lipid bilayer is 30 a thick a calculate the number of amino acids it would take to span the membrane with an helix b calculate the number of amino acids it would take to span t 21491
Uploaded: 2023-02-08T16:54:20-08:00
Duration: 51 s
Channel: Sri K
Description: assume that a lipid bilayer is 30 a thick a calculate the number of amino acids it would take to span the membrane with an helix b calculate the number of amino acids it would take to span t 21491

Here in this case we are considering for a lipid bi layer which is having a thickness of 30 arms

This problem has been solved

by verified expert Sri K

100% free to try

Question

Assume that a lipid bilayer is 30 Å thick. a. Calculate the number of amino acids it would take to span the membrane with an α helix. b. Calculate the number of amino acids it would take to span the membrane with a β-strand. c. Predict the transmembrane portion of the following peptide sequence: RGPKIPSIATGMVGALLLLVVALGIGILFMRRRH.

          Assume that a lipid bilayer is 30 Å thick.
a. Calculate the number of amino acids it would take to span the membrane with an α helix.
b. Calculate the number of amino acids it would take to span the membrane with a β-strand.
c. Predict the transmembrane portion of the following peptide sequence: RGPKIPSIATGMVGALLLLVVALGIGILFMRRRH.

Added by Briana J.

Chemistry: Structure and Properties

Nivaldo Tro 2nd Edition

Thanks for your feedback!

Assume that a lipid bilayer is 30 Å thick. a. Calculate the number of amino acids it would take to span the membrane with an α helix. b. Calculate the number of amino acids it would take to span the membrane with a β-strand. c. Predict the transmembrane portion of the following peptide sequence: RGPKIPSIATGMVGALLLLVVALGIGILFMRRRH.