Mass spectrometry-based sequencing of a peptide results in peaks of the fragments, with the following masses in Da: 746.3204, 615.2799, 518.2271, 417.1795, 330.1474, 227.1382, 156.1011.
Added by Lindsey D.
Step 1
Let's think step by step. Show more…
Show all steps
Your feedback will help us improve your experience
Supreeta N and 89 other Chemistry 101 educators are ready to help you.
Ask a new question
Labs
Want to see this concept in action?
Explore this concept interactively to see how it behaves as you change inputs.
Key Concepts
Recommended Videos
The following amino acid sequence is digested using chymase and analyzed by peptide mass fingerprinting using MALDI-TOF mass spectrometry, scanning between m/z 400 and 1200 and producing only singly charged peptides. This digest results in _________ peptides being formed by hydrolysis, with the peptide with the highest mass detected being an ion at m/z ______________ and the peptide with the lowest mass detected being an ion at m/z ______________. State m/z to 1 decimal place, e.g., if m/z = 235.4, just write 235.4. A list of amino acid masses (as NH-CHR-CO) is provided in the table: Symbol Mass (Da) Ala A 71.0 Arg R 156.1 Asn N 114.0 Asp D 115.0 Cys C 103.0 Gln Q 128.1 Glu E 129.0 Gly G 57.0 His H 137.1 Ile I 113.1 Leu L 113.1 Lys K 128.1 Met M 131.0 Phe F 147.1 Pro P 97.1 Ser S 87.0 Thr T 101.0 Trp W 186.1 Tyr Y 163.1 Val V 99.1 Amino acid sequence: ARYAGGFVNARDPPPATAFPRKEEILKSGLPAF
Supreeta N.
The peptide in Problem 15 was sequenced by tandem mass spectrometry. What are the expected masses of the peptide fragments obtained by this method?
Each peak on the tandem mass spectrogram represents a product ion with a +1 charge. Use the spectrogram and the table of amino acid masses to determine the amino acid sequence of the precursor peptide ion. Answer Bank Ala Arg Asn Asp Gln Glu Gly His Ile Leu Lys Met Phe Pro Ser Thr Trp Tyr Val
Maitreya E.
Recommended Textbooks
Chemistry: Structure and Properties
Chemistry The Central Science
Chemistry
Transcript
Watch the video solution with this free unlock.
EMAIL
PASSWORD