Ace - AI Tutor
Ask Our Educators
Textbooks
My Library
Flashcards
Scribe - AI Notes
Notes & Exams
Download App
malvin faith

malvin f.

Divider

Viewed Questions

Explain how a strong electrolyte, a weak electrolyte, and a nonelectrolyte differ.

Explain how a strong electrolyte, a weak electrolyte, and a nonelectrolyte differ.

Chemistry: Structure and Properties

Questions asked

INSTANT ANSWER

How many normal modes of vibration are expected for Transplatin (trans-[PtCl2(NH3)2])? Ignore the H atoms on the NH3 ligand for this analysis

View Answer
divider
AWAITING AN EDUCATOR

1. Draw D-mannose in its straight chain and its α-pyranose forms.

View Answer
divider
AWAITING AN EDUCATOR

1. Draw D-mannose in its straight chain and its α-pyranose forms.

View Answer
divider
INSTANT ANSWER

Zinc fingers are small proteins that wrap around Zn2+ ions in order to maintain their structures. These proteins then recognize and wrap around specific DNA sequences, and are involved in regulating DNA transcription. In the structure below (PDB ID 3znf), the protein backbone is depicted as “cartoon,” with alpha helices shown as ribbons and strands without secondary structure shown as thin lines. Most of the amino acid side chains are not shown, but the ones that ligate the zinc ion (grey sphere) are rendered as ball and stick. 1) The cysteine residues are shown in their anionic, deprotonated form. What does this tell you about how Zn2+ changes the pKa of the Cys side chains 2.Proteins in this family are among those targeted by lead poisoning in infants and children. What do you think happens to the protein in the presence of Pb2+, and how do you think this could this lead to developmental issues in children 3.The human genome contains 30 types of zinc finger proteins. These are easy to identify in the genome because they have portions that are homologous to one another. Are these different zinc finger proteins orthologs or paralogs? 4.An alignment of zinc finger protein primary sequences shows a strictly conserved (i.e., totally invariant) sequence motif. What amino acids do you think must be encoded within the strictly conserved motif? Why? 5jThe primary structure for the Zn finger protein above is: RPYHCSYCNFSFKTKGNLTKHMKSKAHSKK. How many amino acids in this sequence are nonpolar, polar, acidic, and basic, respectively? The phosphodiester backbone of DNA, as we will see, is highly negatively charged. In light of that, does the composition of the sequence make sense? Why?

View Answer
divider
INSTANT ANSWER

Watch this brief video illustrating how beta sheets are represented in protein structures: https://www.youtube.com/watch?v=jT1XvChhJ8Y 1.How are ribbon-arrows used to represent a parallel beta sheet versus an antiparallel beta sheet? How do the parallel/antiparallel arrangements influence the structure of the beta sheet in the structure shown in the video 2.Where do the amino acid side chains emerge, relative to the amide units that form the basis of the beta sheet?

View Answer
divider
INSTANT ANSWER

Watch this very brief video describing the structure of a protein alpha helix: https://www.youtube.com/watch?v=PeFdl6KmxYM 1. Explain what is meant by the “formal” name of a protein alpha helix, 3.613 helix. As part of your answer, explain the relationship between the “i" and “i + 4” residues in an alpha helix sequence 2 .Do the identities of the amino acid side chains influence the basic helical structure? Why or why not

View Answer
divider
ANSWERED

Aarya B verified

Numerade educator

Draw a tripeptide with the sequence Glu-Asp-Tyr. Label the N- and C-termini.

View Answer
divider
INSTANT ANSWER

Amino acids can be divided into nonpolar, polar, acidic, and basic, with different organic functional groups as their side chains. Consider the following non-proteinogenic amino acid. Note that for some questions, there may be more than one acceptable answer 1. What type of chemical functional group is the side chain of the amino acid below 2. In which of the 4 classes of amino acid would you group this? Why 3.You wish to substitute this amino acid into a protein. You would like to exchange it for an amino acid that it most closely resembles. Which one of the 20 naturally occurring, proteinogenic amino acids does this most resemble to you? Explain your reasoning 4.Draw the protonation state (species) of this amino acid that you expect to predominate at neutral pH:

View Answer
divider
ANSWERED

Aarya B verified

Numerade educator

Cysteine and glycine are not S-amino acids. Explain, using a drawing of each.

View Answer
divider
INSTANT ANSWER

Draw out the acid dissociations of glutamate, histidine, and cysteine, like we did for alanine in class. Show how each structure changes as the pH goes progressively from low to high. Draw out the amino acids in their S-isomeric forms using either the correct Fischer projection or a hashwedge format. Label each acid dissociation reaction with an approximate pKa given in your textbook. (An average pKa for the NH3+ and –COOH acid dissociations common to all amino acids is appropriate.) CIRCLE the chemical species that predominates at neutral pH.

View Answer
divider