Draw the predominant structure of TRACK at pH 11. (5 pts)
Below is part of the amino acid sequence of a protein that contains a loop and an alpha-helix:
~PSEGEPDDAKRRSGVGLEALRVELKRAMSTFEAYNVSLRVVDTV
Draw a circle around the sequence that codes for the loop. Cite three structural features that support this being a loop, or, alternatively, do not support it being an alpha-helix. (6 pts)
Draw a box around the sequence that codes for the alpha-helix. Cite three structural features that support this region being an alpha-helix, and indicate which kinds of attractions are holding the side-chains together: (10 pts - 6 pts for features and 4 pts for attractions)