Protein sequence: MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECE VKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV Number of amino acids: 105 Molecular weight: 11737.5 Highlight all the amino acids in this protein that contribute to the negative charge.
Added by Kadafur S.
Step 1
** Show more…
Show all steps
Your feedback will help us improve your experience
Tanvi Garg and 73 other Chemistry 102 educators are ready to help you.
Ask a new question
Labs
Want to see this concept in action?
Explore this concept interactively to see how it behaves as you change inputs.
Key Concepts
Recommended Videos
Amino Acid Molecular Weight Alanine 89 Arginine 174 Aspartic acid 133 Glutamic acid 146 Glycine 75 Lysine 146 Proline 115 Serine 105 Tyrosine 181 Valine 117 Mass/charge (here the charge is -1, so it's just mass) Above is shown a mass spectroscopy for a peptide 5 amino acids long derived from a soluble protein. This 5 amino acid peptide represents a hydrophilic surface part of the protein (this is a hint as to the composition of this pepetide). Determine and give the amino acid sequence of this pentapeptide. Show which end is the amino terminus and which is the carboxy terminus. NOTE: (1) for simplicities sake not all possible peaks are shown, though all relevant peaks are. (2) Not all amino acids are listed, but all relevant/necessary amino acids are. (3) The masses given should be less by one (loss of H ion to impose a charge on the molecules). To avoid any possible confusion, I left that out.
Sri K.
Amino acids with ionizable side chains are found in all groups except: Negatively-charged amino acids Positively-charged amino acids Hydrophobic amino acids Polar amino acids
Maryam R.
Recommended Textbooks
Chemistry: Structure and Properties
Chemistry The Central Science
Chemistry
Transcript
18,000,000+
Students on Numerade
Trusted by students at 8,000+ universities
Watch the video solution with this free unlock.
EMAIL
PASSWORD