How many amino acids are needed to create a single alpha helix spanning a cell membrane (assume a cell membrane is 8.0 nm thick)? Show your work, including any assumptions
Added by Francisco Javier N.
Step 1
Let's think step by step. Show more…
Show all steps
Your feedback will help us improve your experience
Sri K and 86 other Biology educators are ready to help you.
Ask a new question
Labs
Want to see this concept in action?
Explore this concept interactively to see how it behaves as you change inputs.
Key Concepts
Recommended Videos
If the hydrophobic interior of a membrane were about 3 nm thick, what would be the minimum number of amino acids in a stretch of transmembrane α helix?
Sri K.
Assume that a lipid bilayer is 30 Å thick. a. Calculate the number of amino acids it would take to span the membrane with an α helix. b. Calculate the number of amino acids it would take to span the membrane with a β-strand. c. Predict the transmembrane portion of the following peptide sequence: RGPKIPSIATGMVGALLLLVVALGIGILFMRRRH.
What is the length of a polypeptide with 80 amino acids residues in a single, contiguous α helix? (Hint: An idealized α helix has 3.6 residues per turn and rise along helical axis is 5.4 Å)
Recommended Textbooks
Biology for AP Courses
Objective Biology for NEET
Introduction to General, Organic and Biochemistry
Transcript
18,000,000+
Students on Numerade
Trusted by students at 8,000+ universities
Watch the video solution with this free unlock.
EMAIL
PASSWORD
